PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0163s0047.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 263aa    MW: 30226.2 Da    PI: 7.5846
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0163s0047.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.55.1e-32185243159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vk++++prsYYrC++ +C+vkk+ver aedp++v++tYeg+H h+
  Kalax.0163s0047.1.p 185 LDDGYKWRKYGQKVVKNTQHPRSYYRCSQDSCRVKKRVERLAEDPRMVITTYEGRHAHS 243
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.3E-33170243IPR003657WRKY domain
SuperFamilySSF1182907.98E-28178244IPR003657WRKY domain
PROSITE profilePS5081129.241180245IPR003657WRKY domain
SMARTSM007744.0E-36185244IPR003657WRKY domain
PfamPF031066.1E-25186242IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MSSKSNNQLL QPSFYYIDLN QATTLLTPSE IRHRAMLHHH LSSLFHDAQQ QQQQDHHQEE  60
VLLSSATATH QMGFSSYPAH PSDANNPNFP LLVHPRNINN PFSLYTNSSS SSPNNPSHLS  120
LHKSASNNWA WGEENDDDDD GGDDDHQSYH PLRISAMKMK KIKSSRRKVR EPRFCFKTQS  180
DVDVLDDGYK WRKYGQKVVK NTQHPRSYYR CSQDSCRVKK RVERLAEDPR MVITTYEGRH  240
AHSPSHDLED SDASHGLANF FW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A9e-25177242974Probable WRKY transcription factor 4
1wj2_A9e-25177242974Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007048165.12e-76WRKY DNA-binding protein 13
TrEMBLA0A061DJ422e-76A0A061DJ42_THECC; WRKY DNA-binding protein 13
STRINGVIT_07s0031g01840.t017e-73(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.13e-52WRKY DNA-binding protein 13